PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009595014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 1042aa    MW: 114936 Da    PI: 4.8614
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009595014.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-183682148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WTteEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
   XP_009595014.1 36 KGQWTTEEDEILRKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 82
                     799****************************9.************986 PP

2Myb_DNA-binding64.91.5e-2088134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde +v++vk++G++ W+tIa++++ gR +kqc++rw+++l
   XP_009595014.1  88 KGPWSKEEDEVIVELVKKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 134
                      79******************************.*************97 PP

3Myb_DNA-binding49.87.9e-16140182145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   ++++ gRt++ +k++w+
   XP_009595014.1 140 KEAWTQEEELTLIRAHQIYGNK-WAELTKYLP-GRTDNAIKNHWN 182
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7233182IPR017930Myb domain
SuperFamilySSF466891.36E-153288IPR009057Homeodomain-like
SMARTSM007175.3E-153584IPR001005SANT/Myb domain
PfamPF002499.1E-163682IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-223794IPR009057Homeodomain-like
CDDcd001677.86E-143982No hitNo description
PROSITE profilePS5129434.00783138IPR017930Myb domain
SuperFamilySSF466896.74E-3285181IPR009057Homeodomain-like
SMARTSM007175.3E-1987136IPR001005SANT/Myb domain
PfamPF002492.1E-1888134IPR001005SANT/Myb domain
CDDcd001678.30E-1790134No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2795142IPR009057Homeodomain-like
PROSITE profilePS5129419.653139189IPR017930Myb domain
SMARTSM007176.3E-15139187IPR001005SANT/Myb domain
PfamPF002494.0E-14140183IPR001005SANT/Myb domain
CDDcd001671.69E-11142182No hitNo description
Gene3DG3DSA:1.10.10.601.8E-21143189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1042 aa     Download sequence    Send to blast
MESDRISTPS DGTSSSLQRV RPLHGRTSGP TRRSTKGQWT TEEDEILRKA VQRFKGKNWK  60
KIAECFKDRT DVQCLHRWQK VLNPELVKGP WSKEEDEVIV ELVKKYGPKK WSTIAQHLPG  120
RIGKQCRERW HNHLNPGINK EAWTQEEELT LIRAHQIYGN KWAELTKYLP GRTDNAIKNH  180
WNSSVKKKLD SYLASGLLAQ FPALPNVNRQ NQSIPSSAKL QQSSEDDSVR KEGTEMEEAS  240
ECSQGSNLAG CSQSTSDMGN KFVHTREEGK LLEDSNYRKD PSSSSAPCSE YYTPAFEDIT  300
FSMAEVPSEL DESKLLEHTF SHDWAASIGK EWQFNPDDIP NISPLELMQD SSGLFMQCLT  360
GNGNHDMVTF PQQNAVKFET TNVGSMVVGF DKPNEMFTSV EGCRMVYPEA GIPQYIPSEA  420
GTNGADETAD SLICQSSNYQ ISEGGNMSIE NCNPLCSDVM GTSSGQPFSI PSQFSSEQSS  480
LMFGTAANQF HNPLQGNPAQ ESHTSNSDGF LYPFESGTPC DNIMDDPLLE EQLDQTKDSL  540
QLVSVNDFRT TPSNTIQTCP LVNENSSIPV EQKDGGALYY EPPRFPSLDI PFFSCDLIQS  600
GTDAQQEYSP LGIRQLMMTS VNCLTPFRLW DSPSRDGSTD AVLRSAAKTF TSTPSILKKR  660
HRDLVSPLSE KRCEKKLGSD FRQESFSDLS KDFSRLDVMF DEAANEKATK SSLTTDQTLE  720
LEASSEDKEN INPTEDGSKE EDKVRNGLSN ERQLDGGEVH YKEKGTREGT KGGANSAIGK  780
IKQPSGVLVE LNASDLFFSP DRFGAKSGRA TYLSSKALGN QYARRLEAAS NQGSVSSSFE  840
TSCFSVICSP RIRGKKDGSS FIITTSMQSA PAPTALDNSA ETSGNGVGAE TVSISGETPY  900
KRSIESPSAW KSPWFINSLL SSPRLDNELN FEDLALFMSP GDRSYDAIGL MKQLSEQTAG  960
AFADAQEVLG GETPESILRG RNSKNQKADE NHSLLSANVM SERRTLDFSE CGSPGKGKET  1020
EIFCTSNNSF SSPSSYLLKG CR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-69361896159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-69361896159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0561230.0AB056123.1 Nicotiana tabacum NtmybA2 mRNA for Myb, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595014.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLQ948S50.0Q948S5_TOBAC; Myb
STRINGSolyc08g068320.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4